Bacterial taxon 373153
Protein WP_001069051.1
preprotein translocase subunit YajC
Streptococcus pneumoniae D39
Gene yajC-2, UniProt A0A0H2ZP20
>WP_001069051.1|Streptococcus pneumoniae D39|preprotein translocase subunit YajC
MNPNITFLIMLVGMMALMFFMQRSQKKQAQKRMESLNKLQKGYEVITIGGLYGTVDEVDTEKGTIVLDVDGVYLTFELAAIKTVLPLKETASLEGAIEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.46 | 1.46379576899508 | 2.3e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.42 | 1.41828829799819 | 4.0e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.41 | 1.40767976934993 | 8.3e-19 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)