Bacterial taxon 373153
Protein WP_000282517.1
preprotein translocase subunit SecG
Streptococcus pneumoniae D39
Gene secG, UniProt A0A0H2ZQX6
>WP_000282517.1|Streptococcus pneumoniae D39|preprotein translocase subunit SecG
MYNLLLTILLVLSVVIVIAIFMQPTKNQSSNVFDASSGDLFERSKARGFEAVMQRLTGILVFFWLAIALALTVLSSR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.16 | -1.15938435747826 | 5.8e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.79 | -0.794201876253172 | 0.0066 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.77 | -0.773326528165229 | 0.0086 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)