Bacterial taxon 373153
Protein WP_001210991.1
preprotein translocase subunit SecE
Streptococcus pneumoniae D39
Gene secE, UniProt A0A0H2ZQZ7
>WP_001210991.1|Streptococcus pneumoniae D39|preprotein translocase subunit SecE
MRFIGDIFRLLKDTTWPTRKESWRDFRSIMEYTAFFVVIIYIFDQLIVSGLIRFINIF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.77 | -0.77092023342517 | 5.5e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.68 | -0.679966186259299 | 6.7e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.65 | -0.649035509216185 | 0.00013 | 27678244 | |
Retrieved 3 of 1 entries in 2 ms
(Link to these results)