Bacterial taxon 373153
Protein WP_000565010.1
prepilin peptidase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPC4
>WP_000565010.1|Streptococcus pneumoniae D39|prepilin peptidase
MIDFYFFLVGSILASFLGLVIDRFPEQSIISSASHCDSCQTRLRPLDLIPILSQVFNRFCCRYCKVRYPVWYALFELGLGLLFLLYSWELLSLSQVILITAGLTLGIYDFRHQEYPLLVWMTFHLILIASSGWNLVMVSFLILGILAHFIDIRMGAGDFLFLASCALVFSVTELLILIQFASATGILAFLLQKKKERLPFVPFLLLAACVIIFGKLLLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 4.98 | 4.97730101312801 | 2.3e-72 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.36 | 2.36380233337764 | 2.8e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.03 | 2.03433363221184 | 5.2e-13 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)