Host taxon 9606
Protein NP_001288030.1
phosphopantothenoylcysteine decarboxylase isoform b
Homo sapiens
Gene PPCDC, UniProt Q96CD2
>NP_001288030.1|Streptococcus pneumoniae D39|phosphopantothenoylcysteine decarboxylase isoform b
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLYSDADEWETCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.58 | -1.58433662623647 | 7.4e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.89 | -0.889230921726533 | 0.035 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.66 | -0.658317246934991 | 0.03 | 27678244 | |
Retrieved 3 of 5 entries in 0.8 ms
(Link to these results)