Bacterial taxon 373153
Protein WP_000699498.1
phosphopantothenate--cysteine ligase
Streptococcus pneumoniae D39
Gene coaB, UniProt A0A0H2ZPA4
>WP_000699498.1|Streptococcus pneumoniae D39|phosphopantothenate--cysteine ligase
MKILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGHEVCLITTKRALKPEPHPNLSIREVTNTKDLLIEMQERVQDYQVLIHSMAVSDYTPVYMTGLEEVQASSNLKEFLSKQNHQAKISSTDEVQVLFLKKTPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKNQLQTVQTKEEIAELLLEKIQAYHS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.38 | 1.38339046575204 | 1.7e-29 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.34 | 1.34071732625988 | 1.4e-27 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.27 | 1.2661969927214 | 1.1e-24 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)