Bacterial taxon 373153
Protein WP_000146947.1
phosphocarrier protein HPr
Streptococcus pneumoniae D39
Gene ptsH, UniProt A0A0H2ZP52
>WP_000146947.1|Streptococcus pneumoniae D39|phosphocarrier protein HPr
MASKDFHVVAETGIHARPATLLVQTASKFASDITLEYKGKSVNLKSIMGVMSLGVGQGADVTISAEGADADDAIAAISETMEKEGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.16 | 1.15897130796203 | 4.1e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.13 | 1.13297225093528 | 2.7e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.05 | 1.04765807181742 | 2.4e-18 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)