Bacterial taxon 373153
Protein WP_000872894.1
phosphatidylglycerophosphatase A
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM35
>WP_000872894.1|Streptococcus pneumoniae D39|phosphatidylglycerophosphatase A
MKYDLYDNCIELLKEREVTIEDMAALVIFSQQKYYPELTLDDASYAIQRVLKKREVQNVIMTGIELDKLAEAQKLSPEFQKIMEKDNPLYGIDEVIVLSILNLYGSIAFTNYGYLDKLKPLILERLNENHEGVCNVFLDDIVGAIAAAACSKIAHNHASDEI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.06 | 2.06244051105031 | 6.2e-61 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.77 | 1.76841841317571 | 7.0e-45 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.23 | 1.23440383597421 | 1.1e-22 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)