Bacterial taxon 373153
Protein WP_000536835.1
phage repressor protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMM4
>WP_000536835.1|Streptococcus pneumoniae D39|phage repressor protein
MGTKIGISKNTIRNYEKRVRSTKKNTIFDLVKVFSSLIDALFPPVQKDSPSDIQSIYDQRAPPRQGKVLTYAERQLYDQKNEVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.85 | -1.8450275413267 | 7.2e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.95 | -0.945237701742569 | 0.0003 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.879183575257958 | 0.00083 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)