Bacterial taxon 373153
Protein WP_000761896.1
peptide chain release factor N(5)-glutamine methyltransferase
Streptococcus pneumoniae D39
Gene hemK, UniProt A0A0H2ZRD8
>WP_000761896.1|Streptococcus pneumoniae D39|peptide chain release factor N(5)-glutamine methyltransferase
MKLAQLFSNFEEELIRQGEEAESLSFVYRSLKNLSFTDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTENLETNLSVLDIGTGSGAIALALAKNRPDWSVTAADISQEALDLARENAKNQNLQIFLKKSDCFTEISEKYDIIVSNPPYISREDESEVGLNVLYSEPHLALFADEDGLAIYRRIAEDATDYLKDSGKIYLEIGYKQGQCVPELFRKHLPEKRVRTLKDQFGQNRMVVVDDGQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.52 | 1.52291949388972 | 5.9e-26 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.5 | 1.5039617831618 | 3.2e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.4 | 1.39865094114173 | 5.2e-22 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)