Bacterial taxon 373153
Protein WP_001836117.1
peptide ABC transporter substrate-binding protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM54
>WP_001836117.1|Streptococcus pneumoniae D39|peptide ABC transporter substrate-binding protein
MVLSTLAILVACGKTDKEADAPTTFSYVYAVDPASLGYSITTRTSTTDVIGNVIDGLMENDKYGNVAPSQKDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEKRYEKYAKAQAWSTDSSLLMPTASSGGSPIVSNVVPFSKPYSQVGIKGEPYIFKGMKLQKDIVTTKEYNEVFKKWQKEKLESNSKYQKELEKHIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.88 | 0.881739773673057 | 1.3e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.78 | 0.777828542346228 | 8.8e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.61 | 0.611921078618313 | 3.7e-7 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)