Bacterial taxon 373153
Protein WP_000273864.1
PadR family transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN96
>WP_000273864.1|Streptococcus pneumoniae D39|PadR family transcriptional regulator
MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIRHDKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.34 | -2.34333756221475 | 1.2e-26 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.1 | -2.09634850629045 | 2.7e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.03 | -2.0327673444976 | 6.0e-21 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)