Bacterial taxon 373153
Protein WP_000170913.1
orotate phosphoribosyltransferase
Streptococcus pneumoniae D39
Gene pyrE, UniProt Q04LJ2
>WP_000170913.1|Streptococcus pneumoniae D39|orotate phosphoribosyltransferase
MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAYPETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGAGNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNFADAGVKLVTLSNYSDLIHLAQEEGYITPEGLYLLKRFKEDQENWQEG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●●● 5 | 4.99728474425892 | 9.0e-142 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 4.29 | 4.2893682503765 | 1.0e-104 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●○ 3.58 | 3.57674158005421 | 5.8e-73 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)