Bacterial taxon 373153
Protein WP_000499433.1
noncanonical pyrimidine nucleotidase, YjjG family
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPD2
>WP_000499433.1|Streptococcus pneumoniae D39|noncanonical pyrimidine nucleotidase, YjjG family
MFYKFLLFDLDHTLLDFDAAEDVALTQLLKEEGVADIQAYKDYYVPMNKALWKDLELKKISKQELVNTRFSRLFSHFGQEKDGSFLAQRYQFYLAQQGQTLSGAHDLLDSLIERDYDLYAATNGITAIQTGRLAQSGLVPYFNQVFISEQLQTQKPDALFYEKIGQQIAGFSKEKTLMIGDSLTADIQGGNNAGIDTIWYNPHHLENHTQAQPTYEVYSYQDLLDCLDKNILEKITF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.52 | 2.52174436938978 | 7.1e-64 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.45 | 2.44716530908086 | 1.4e-60 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.35 | 2.35168171994344 | 1.8e-55 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)