Bacterial taxon 373153
Protein WP_000670172.1
nitroreductase family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZR18
>WP_000670172.1|Streptococcus pneumoniae D39|nitroreductase family protein
MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPWKFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQLQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYTDDKLEPSYRLPVDEIIEKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.49 | -0.485644029926664 | 1.7e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.35 | -0.354291749597856 | 0.00054 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.29 | 0.288959768211546 | 0.0046 | 27678244 | |
Retrieved 3 of 1 entries in 2.1 ms
(Link to these results)