Bacterial taxon 373153
Protein WP_000151313.1
nicotinate-nucleotide adenylyltransferase
Streptococcus pneumoniae D39
Gene nadD, UniProt A0A0H2ZM20
>WP_000151313.1|Streptococcus pneumoniae D39|nicotinate-nucleotide adenylyltransferase
MTIELLTPFTKVELEPEIKEKKRKQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMPEYQPPHVDKKETIPEHHRLKMLELAIEGIDGLVIETIELERKGISYTYDTMKILTEKNPDTDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRYKVGTSYPVIWVDVPLMDISSSMVRDFLAQGRKPNFLLPQPVLDYIEKEGLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.92 | -0.921904121475511 | 8.7e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.64 | -0.639302540953577 | 2.7e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.27 | -0.26515384713952 | 0.037 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)