Bacterial taxon 373153
Protein WP_000039616.1
NAD(P)H-dependent oxidoreductase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRU6
>WP_000039616.1|Streptococcus pneumoniae D39|NAD(P)H-dependent oxidoreductase
MSKKVLFIVGSLRQGSFNHQMALEAEKALAGKAEVSYLDYSALPLFSQDLEVPTHPAVAAAREAVLVADAIWIFSPVYNFSIPGTVKNLLDWLSRALDLSDTRGVSALQDKFVTVSSVANAGHDQLFAIYKDLLPFIRTQGVGDFTAARVNDSAWADGKLVLEETVLNPLEKQAQDLVEAIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.17 | 2.17380256321976 | 1.4e-36 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.11 | 1.10747834365674 | 2.4e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.06 | 1.0567865420945 | 1.4e-9 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)