Bacterial taxon 373153
Protein WP_000915944.1
NAD(P)H-dependent oxidoreductase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP54
>WP_000915944.1|Streptococcus pneumoniae D39|NAD(P)H-dependent oxidoreductase
MLKLIAIVGTNSKRSTNRQLLQYMQKHFADKAEIELVEIKTIPVFNKPADKQVPAEILEIAAKIEEADGVIIGTPEYDHSIPAVLMSALAWLSYGIYPLLNKPIMITGASYGTLGSSRAQLQLRQILNAPEIKANVLPDEFLLSHSLQAFNPSGDLVDLDVIKKLDAIFDDFRIFVKITEKLRNAQELLRKDAEDFDWENL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.03 | -1.0276981241318 | 0.00018 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.66 | -0.655436439881747 | 0.02 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.65 | -0.649134134312124 | 0.021 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)