Bacterial taxon 373153
Protein WP_000762101.1
NAD(P)-dependent oxidoreductase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNI0
>WP_000762101.1|Streptococcus pneumoniae D39|NAD(P)-dependent oxidoreductase
MKLAVIAANGQVGKAIVEEAVKRGHEVTAIVRSENKSQAESIIKKDLFELTKDDLTGFDAVISAFGAYTPDTLPLHSKSIELFNQLLAGTQTRFLVVGGAGSLYIDETKTTRLLDTPDFPEEFKSLAKAQADELDLLRTKNNLNWTFVSPAVDFIPDGEKTGNYILAGEIFTTNEKGISQISYADYAIGLVDELEKGHHIKERISLLEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.66 | 1.65711672467175 | 2.2e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.14 | 1.14173882198327 | 0.004 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.04 | 1.04112924837821 | 0.0078 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)