Bacterial taxon 373153
Protein WP_001042503.1
N-acetylmuramoyl-L-alanine amidase family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNY8
>WP_001042503.1|Streptococcus pneumoniae D39|N-acetylmuramoyl-L-alanine amidase family protein
MNKRLFLKMSLVTLPILALFSQPVLAEENIHFSSCKEAWANGYSDIHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQSTAIQINTSSATTSGWVKQDGAWYYFDGNGNLVKNAWQGSYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYAKNAWQGAYYLKSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQAWYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQASTASSSNDSNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.69 | 0.685389351966207 | 3.1e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.68 | 0.675768194136961 | 3.8e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.44 | 0.436284405395336 | 0.0033 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)