Bacterial taxon 373153
Protein WP_000078389.1
N-acetylmannosamine-6-phosphate 2-epimerase
Streptococcus pneumoniae D39
Gene nanE-2, UniProt A0A0H2ZPZ3
>WP_000078389.1|Streptococcus pneumoniae D39|N-acetylmannosamine-6-phosphate 2-epimerase
MSQISKEALIEQIKDGIIVSCQALPHEPLYTEAGGVIPLLVKAAEQGGAVGIRANSVRDIKEIKEVTKLPIIGIIKRDYPPQEPFITATMKEVDELAELDIEVIALDCTKRERYDGLEIQEFIRQVKEKYPNQLLMADTSIFEEGLAAVEAGIDFVGTTLSGYTSYSPKVDGPDFELIKKLCDAGVDVIAEGKIYTPEQAKQILEYGVRGIVVGGAITRPKEITERFVAGLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.33 | 1.32634676132377 | 3.6e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.14 | 1.14321076256605 | 4.5e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.72 | 0.719426034342909 | 9.8e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)