Bacterial taxon 373153
Protein WP_000837499.1
MutR family transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNB8
>WP_000837499.1|Streptococcus pneumoniae D39|MutR family transcriptional regulator
MKSKLGVTLRKIRKGKQISLCSVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTKTESFANLVQYIRKQYSSQSINNIACLLSDTSDYTLNSFEKTMVKSILHTMDSNIIPSDEELLHLTDYLFKIEKWGYYEIILLGNCVRTINYNSYFLLTKEMLNNYIYSSLNKTNKQIVSQLAINCFILSIDKEEFSNCSYLISKIKTLLDNELNFYEQTVFLYATGYFEFKRCQSTSGIEKMKQAIQVFDILGENKLKLHYTDHFNKPVNKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.37 | 2.36666912766368 | 1.2e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.12 | 2.12245768509163 | 2.9e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.44 | 1.43812667384999 | 2.0e-11 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)