Bacterial taxon 373153
Protein WP_000748394.1
MptD family putative ECF transporter S component
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPF5
>WP_000748394.1|Streptococcus pneumoniae D39|MptD family putative ECF transporter S component
MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALVGGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADGVAHLGKYKDKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLFIASIVIGALVGALIGQALSKKFAQKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.77 | -0.769630632908196 | 4.4e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.65 | -0.647959146160023 | 5.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.62 | -0.61828817602059 | 1.9e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)