Bacterial taxon 373153
Protein WP_000567914.1
Mini-ribonuclease 3
Streptococcus pneumoniae D39
Gene mrnC, UniProt A0A0H2ZMB1
>WP_000567914.1|Streptococcus pneumoniae D39|Mini-ribonuclease 3
MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATKYVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMGYLHMTENLERLESLVSWCIQKVEG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.09 | -1.08856678955445 | 1.4e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.59 | -0.588249837192725 | 7.8e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.59 | -0.586008391403806 | 7.3e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)