Bacterial taxon 373153
Protein WP_000089991.1
methylenetetrahydrofolate reductase [NAD(P)H]
Streptococcus pneumoniae D39
Gene metF, UniProt A0A0H2ZP69
>WP_000089991.1|Streptococcus pneumoniae D39|methylenetetrahydrofolate reductase [NAD(P)H]
MSRQTPSLSFEVFPPTPAVGNDNIISALQDMQELAPHFISVTASNNKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGDIIPDVEPQKDFRYATDLIELIKERAPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAGCSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRKFKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDIAGVHLYTMNNADTAKYIHQATHALFNHQSLG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.01 | 1.009539414967 | 9.5e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.87 | 0.873835300766077 | 0.00089 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.63 | 0.631126015618506 | 0.018 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)