Bacterial taxon 373153
Protein WP_001204051.1
metal-sulfur cluster assembly factor
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP01
>WP_001204051.1|Streptococcus pneumoniae D39|metal-sulfur cluster assembly factor
MRDDIKINDRALALQDQIIEKLEKVFDTDVELDVYNLGLIYEINLDETGLCKIVMTFTDTACDCAESLPIEIVAGLKQIEGIEDIKVEVTWSPAWKITRISRYGRIALGLPPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.49 | 1.49452696729065 | 3.3e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.18 | 1.18039096061034 | 0.0012 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.96 | 0.956029374106374 | 0.0094 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)