Bacterial taxon 373153
Protein WP_000185155.1
metal-sensitive transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNA4
>WP_000185155.1|Streptococcus pneumoniae D39|metal-sensitive transcriptional regulator
MTNSKYITCLKRSEGQLRGIQKMIEGDRDCADIVTQLTAVRSSVERVIEMIITENLTECINQPLDDSEAQKERLEKAIRYLIKRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.78 | 1.78003256846516 | 2.6e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.27 | 1.27307598435115 | 2.8e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.93 | 0.929975964247663 | 1.8e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)