Bacterial taxon 373153
Protein WP_000429499.1
membrane protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPU8
>WP_000429499.1|Streptococcus pneumoniae D39|membrane protein
MENLTNFYEKYRVYLTRPRLELLAVVTIVFCAVLVFFLNIPGKGVLKLDNGTIVYDGSLVRGKMNGQGTITFQNGDQYTGGFNNGAFNGKGTFQSKEGWTYEGDFVNGQAEGKGKLTTEQEVVYEGTFKQGVFQQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.18 | 1.17575420503396 | 6.6e-31 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.09 | 1.09400227103875 | 9.7e-27 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 1 | 0.995101688688139 | 2.4e-22 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)