Bacterial taxon 373153
Protein WP_000725742.1
membrane protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ22
>WP_000725742.1|Streptococcus pneumoniae D39|membrane protein
MKKKAFGIVLLVLAAWILLQGNFGIPSLDGKIWPLLGIVFFAYKSIESILRRHLTSAVFTGLLAIIIANYAYDLLPVTNHSLIWASILVVLGVGYLTHSSKFWNEKKWWYNGKKTVVTDKEVAFGSGTFYKQDQDLVDDQVEVAFGDAKIYYDNAEMLGDFATLNIEVAFGNATVYVPQHWRVDLKVETSFGAAKADAPVAPTSKTLTIRGDVAFGKLEIVYVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.16 | 2.16305686759944 | 6.1e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.07 | 2.07039492042054 | 4.8e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.13 | 1.12738042389238 | 1.2e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)