Bacterial taxon 373153
Protein WP_000166031.1
MazG-like protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRG5
>WP_000166031.1|Streptococcus pneumoniae D39|MazG-like protein
MTKQGRYYDETPYTLEQKLSENIWWLLELSQRLDIDILTEMENFLSDKEKQLNVRTRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.5 | -1.50449077874345 | 5.8e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.28 | -1.28167350068181 | 4.6e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.22 | -1.22188430519846 | 4.2e-14 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)