Bacterial taxon 373153
Protein WP_001249319.1
MarR family transcriptional regulator
Streptococcus pneumoniae D39
Gene adcR, UniProt Q04I02
>WP_001249319.1|Streptococcus pneumoniae D39|MarR family transcriptional regulator
MRQLAKDINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEHHHHHEHTLLTYEQVATQFTPNEQKVIQRFLTALVGEIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.8 | 0.802854839725876 | 4.4e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.71 | 0.709155396499532 | 6.6e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.29 | 0.290035325439643 | 0.0065 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)