Bacterial taxon 373153
Protein WP_000386347.1
MarR family transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNZ9
>WP_000386347.1|Streptococcus pneumoniae D39|MarR family transcriptional regulator
MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIGKAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHRLHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.38 | -2.38403648535224 | 1.7e-163 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.24 | -2.2440969613583 | 2.7e-145 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.86 | -1.86485177139701 | 5.5e-101 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)