Bacterial taxon 373153
Protein WP_001294319.1
mannose-6-phosphate isomerase, class I
Streptococcus pneumoniae D39
Gene manA, UniProt A0A0H2ZPC2
>WP_001294319.1|Streptococcus pneumoniae D39|mannose-6-phosphate isomerase, class I
MSEPLFLQSVMQEKIWGGTKLRDEFGYDIPSEKVGEYWAISAHLNGVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKILDANDWLSVQVHPDDAYGLEHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIEDKNWDALLTKVPVKAGDFFYVPSGTMHAIGAGILILETQQSSDTTYRVYDFDRKDDKGNLRELHLEKSIDVLNIGEPANSRPVTIKADDLRSTLLVSNDFFAVYKWEITGKVNFEKTADYSLLSVLAGQGQLTVDGKNYPIQKGRHFILPSDVESWTLEGQDLELIVSHP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.4 | 2.40165005162636 | 3.9e-80 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.21 | 2.21388570804519 | 5.1e-68 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.21 | 2.21031142293966 | 2.5e-68 | 27678244 | |
Retrieved 3 of 1 entries in 1.5 ms
(Link to these results)