Bacterial taxon 373153
Protein WP_000912955.1
M50 family metallopeptidase
Streptococcus pneumoniae D39
Gene slgP1, UniProt A0A0H2ZNT0
>WP_000912955.1|Streptococcus pneumoniae D39|M50 family metallopeptidase
MLKILNNSVIYLCLIPLLFLLLIIFPNDSLIYYFRLILISLISITLHELGHFLVGRCLSYKLEMLATPFFFYFRKKIYFKFPVLLAFGYCQMSNRNITNEKNSDRNLVFYFFGGSGANLIVAILALLGFVPYASEFFILNIILFLVTVCLPIDGTDGNAIREIVLYSKDSKTYQRFFANSLYNNPYITIDDFAKLTSKEKSFFSKFEKCLINLYFEVKGEGSAFTIANHEVFDSNIQENIIHEYYKLLHKSSDWIIPQNLSLEEVVFTLSNYIYSKNNKYLEKIKYLKKLVDFRQEEIIDFILNKEEVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ 3.35 | 3.34550264078291 | 5.4e-54 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.92 | 2.91570314641185 | 2.9e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.3 | 2.29919109245184 | 3.4e-26 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)