Bacterial taxon 373153
Protein WP_000476388.1
lysozyme family protein
Streptococcus pneumoniae D39
Gene pvaA, UniProt A0A0H2ZQP0
>WP_000476388.1|Streptococcus pneumoniae D39|lysozyme family protein
MFKRIRRVLVLAVFLFAGYKAYRVHQDVKQVMTYQPMVREMLSEKDTPANEELVLAMIYTETKGKEGDVMQSSESASGSTNTINDNASSIRQGIQTLTGNLYLAQKKGVDIWTAVQAYNFGPAYIDFIAQNGKENTLALAKQYSRETVAPLLGNRTGKTYSYIHPISIFHGAELYVNGGNYYYSRQVRLNLYIIKCFTLFSTSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.87 | 0.868892178892731 | 9.7e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.35 | 0.351731368877295 | 0.00023 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.28 | 0.275993171512299 | 0.0039 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)