Bacterial taxon 373153
Protein WP_000836441.1
LysM peptidoglycan-binding domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQH1
>WP_000836441.1|Streptococcus pneumoniae D39|LysM peptidoglycan-binding domain-containing protein
MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYGSWTAAKNFWLNNGWY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.61 | 2.60733851732631 | 1.9e-43 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.11 | 1.11066893982686 | 6.8e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.96 | 0.959846376451676 | 6.5e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)