Bacterial taxon 373153
Protein WP_000737448.1
low molecular weight phosphotyrosine protein phosphatase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ64
>WP_000737448.1|Streptococcus pneumoniae D39|low molecular weight phosphotyrosine protein phosphatase
MKKLVFVCLGNICRSPMAEFVMKSMTDNYEIQSRATSSWEHGNPIHKGTQGIFQQYEIPYDKNKTSLQISKEDFEAFDYIIGMDASNISDLRQMCPVDCQDKIYSFSSESVPDPWYTGDFEETYRRVQEGCQAWLERLEKES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.4 | 1.39999481908615 | 2.2e-43 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.38 | 1.37705995853716 | 8.9e-42 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.23 | 1.23344662219853 | 9.8e-34 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)