Bacterial taxon 373153
Protein WP_000916795.1
large conductance mechanosensitive channel protein MscL
Streptococcus pneumoniae D39
Gene mscL, UniProt A0A0H2ZMT3
>WP_000916795.1|Streptococcus pneumoniae D39|large conductance mechanosensitive channel protein MscL
MLKNLKSFLLRGNVIDLAVGVVIASAFGAIVTSLVNDIITPLILNPALKAAKVERIAQLSWHGVGYGNFLSAIINFIFVGTALFFIIKGIEKAQKLTGIKKEKTAEKKPTELEVLQEIKALLEKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.34 | -1.33700948840283 | 1.0e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.31 | -1.30681006527257 | 3.1e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.15 | -1.15483373104088 | 1.6e-10 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)