Bacterial taxon 373153
Protein WP_000157154.1
lactoylglutathione lyase
Streptococcus pneumoniae D39
Gene gloA, UniProt A0A0H2ZN15
>WP_000157154.1|Streptococcus pneumoniae D39|lactoylglutathione lyase
MASKMLHTCLRVENLEKSIAFYQDAFGFKELRRRDFPDHAFTIVYLGLEGDDYELELTYNYDHGPYVVGDGFAHIALSTPDLEALHQEHSAKGYEVTEPNGLPGTTPNYYFVKDPDGYKVEVIREK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.85 | -2.85070276497718 | 2.2e-239 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.67 | -1.6719963739488 | 1.5e-83 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.24 | -1.23563968926332 | 3.3e-46 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)