Bacterial taxon 373153
Protein WP_000120724.1
lactate oxidase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN83
>WP_000120724.1|Streptococcus pneumoniae D39|lactate oxidase
MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFTSFQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.17 | 2.16825206163332 | 3.1e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.53 | 1.52780802546498 | 8.5e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.42 | 1.41946199032294 | 2.4e-15 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)