Bacterial taxon 373153
Protein WP_000379621.1
KH domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMB4
>WP_000379621.1|Streptococcus pneumoniae D39|KH domain-containing protein
MDTIENLIIAIVKPLISQPDALTIKIEDTPEFLEYHLNLDQSDVGRVIGRKGRTISAIRTIVYSVPTEYKKVRIVIDEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.81 | -2.81041761621463 | 1.5e-112 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.79 | -0.790389775280575 | 4.7e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.78 | -0.7807212955424 | 7.2e-10 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)