Bacterial taxon 373153
Protein WP_000818079.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN04
>WP_000818079.1|Streptococcus pneumoniae D39|hypothetical protein
MKREVISNGNDGPSQEILIFTKQIRHWILSDQVISGKRKLFFREDTPKEILDLYENIKSKLDFAYQEVYSNNGLKKYEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.02 | -1.01517917505001 | 9.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.86 | -0.85965569020594 | 0.0011 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.71 | -0.711247806583892 | 0.0073 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)