Bacterial taxon 373153
Protein WP_001809903.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPH8
>WP_001809903.1|Streptococcus pneumoniae D39|hypothetical protein
MNLIFEEYQFVKIGDKKYRVRSGPMIHSTPPQSVLDRDTFTIDYTDDELLDKEAVFTTH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.26 | -1.25978672646159 | 4.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.11 | -1.10848136709404 | 0.00036 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.04 | -1.03873135638955 | 0.0007 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)