Bacterial taxon 373153
Protein WP_000737927.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPN7
>WP_000737927.1|Streptococcus pneumoniae D39|hypothetical protein
MKKLYRIHFIAIAVIDLLLFAFFITRLETSFEWLLLSGLIFFLAQGLLLFLLVVRLKHQFAEIYPQINKKIRFYYLGVLTIDFLFFVLLAFISSQRFSSLMPIITACHSTFYYMTADYLRENYPDFYDKHISNTYTILSISSFLV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.45 | 1.4491304023451 | 1.5e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.34 | 1.3435828493939 | 3.6e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.7 | 0.701134015260946 | 2.7e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)