Bacterial taxon 373153
Protein WP_000266233.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMY7
>WP_000266233.1|Streptococcus pneumoniae D39|hypothetical protein
MWLIILWNAKPDTPLFNFKDEVIKYKTYEPFESSIKRVNTTIKNGSKGKTLTEMINGYRADNDIRDEICNFNILKNKIRDMKDQQGNTMESYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.43 | 2.43477751189744 | 3.3e-53 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.2 | 2.19889175229899 | 9.4e-43 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.15 | 2.14866631089402 | 3.5e-41 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)