Bacterial taxon 373153
Protein WP_000995820.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN25
>WP_000995820.1|Streptococcus pneumoniae D39|hypothetical protein
MNCRGHETRQRIVRDFEVQPKVHIKLLANQQKHSDAGATIEDEYYVFIAESKIDGKKEVIQCCMGAARDFLELINHKGLPLFNPLVGDSHVNNRQEYDNTGSGNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.26 | 2.2585981172809 | 3.6e-57 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.13 | 2.1293209716463 | 2.4e-50 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2 | 2.00086048217525 | 5.8e-44 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)