Bacterial taxon 373153
Protein WP_000226583.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNV2
>WP_000226583.1|Streptococcus pneumoniae D39|hypothetical protein
MVASASASSTSTQAQEQVDKSELRALSQELDQRLKALATVSDPKIDATKAVLLDAQKAPEDSALTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.96 | 1.96269758316868 | 2.5e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.79 | 1.7929880994913 | 1.1e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.6 | 1.59503933372403 | 4.5e-8 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)