Bacterial taxon 373153
Protein WP_000348829.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQD5
>WP_000348829.1|Streptococcus pneumoniae D39|hypothetical protein
MDGKVDGNYGHNSVTHTNFQSKPWWQVDLAKEETIRQINIYNRTDTAQDRLANFDVILLDSSGKEIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.89 | -0.894816067694844 | 2.8e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.87 | -0.866184989319939 | 5.4e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.62 | -0.618733164303941 | 0.00043 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)