Bacterial taxon 373153
Protein WP_000276498.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ60
>WP_000276498.1|Streptococcus pneumoniae D39|hypothetical protein
MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFNFLNSMLALMAIFIGAGYVVGFWLLILNENQRAN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.56 | -2.55676726492851 | 5.8e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.01 | -2.01424161287604 | 2.1e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.5 | 1.50420017682822 | 4.2e-8 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)