Bacterial taxon 373153
Protein WP_001819829.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPX6
>WP_001819829.1|Streptococcus pneumoniae D39|hypothetical protein
MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETLEKGPESNDSSLSEISPTYG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.92 | 0.924402327203924 | 8.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.73 | 0.726311602623895 | 0.0021 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.64 | 0.643523810859939 | 0.007 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)